PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi5g15760.1.p
Common NameBRADI_5g15760, LOC100843834
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 270aa    MW: 29677.1 Da    PI: 6.1095
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi5g15760.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.5e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT+eEd+ lv  +k +G g+W++ ++  g+ R++k+c++rw +yl
  Bradi5g15760.1.p 14 RGPWTPEEDKTLVAHIKSFGHGNWRALPKQAGLLRCGKSCRLRWINYL 61
                      89******************************99************97 PP

2Myb_DNA-binding48.22.4e-1567112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg+++  E++ +++++++lG++ W++Ia++++ gRt++++k+ w+++l
  Bradi5g15760.1.p  67 RGNFSDVEEQTIIQLHELLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112
                       89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.0E-25564IPR009057Homeodomain-like
PROSITE profilePS5129415.952961IPR017930Myb domain
SuperFamilySSF466891.39E-2910108IPR009057Homeodomain-like
SMARTSM007173.1E-131363IPR001005SANT/Myb domain
PfamPF002497.2E-151461IPR001005SANT/Myb domain
CDDcd001677.83E-111661No hitNo description
PROSITE profilePS5129423.61162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-2565116IPR009057Homeodomain-like
SMARTSM007178.3E-1466114IPR001005SANT/Myb domain
PfamPF002492.4E-1467112IPR001005SANT/Myb domain
CDDcd001673.16E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MGRAPCCEKM GLKRGPWTPE EDKTLVAHIK SFGHGNWRAL PKQAGLLRCG KSCRLRWINY  60
LRPDIKRGNF SDVEEQTIIQ LHELLGNRWS AIAARLPGRT DNEIKNVWHT HLKKRLDPSA  120
SARQEHDEEE GQQANKKRKP AAASRKRKPA ATAPVSSPER SVSTSTVTES SMAVEHGNSG  180
SSAVSVKEES FTSASEESDE FQIDESFWSE TLSMPLLVSG SNNDVVASME PHEAFGAGSS  240
SVDGDMDYWL RVFMEGGGDD DVALDLPQI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-27121175109B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00375DAPTransfer from AT3G23250Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3539291e-145AK353929.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1003N07.
GenBankAK3598801e-145AK359880.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1105F18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580139.10.0PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH41e-107MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLI1IZP30.0I1IZP3_BRADI; Uncharacterized protein
STRINGBRADI5G15760.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.13e-78myb domain protein 15